PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678331411
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 392aa    MW: 44042.8 Da    PI: 6.4278
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678331411genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.69.1e-083283612154
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                k +yp++e++++L +++gL+ +q+ +WF N+R +
  678331411 328 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 361
                569*****************************87 PP

2ELK29.41.8e-10282303122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELKh+L+++Y+ +++++++E++
  678331411 282 ELKHELKQGYKDKIVDIREEIL 303
                9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.6E-20116160IPR005540KNOX1
PfamPF037901.5E-17118159IPR005540KNOX1
SMARTSM012564.8E-25169225IPR005541KNOX2
PfamPF037911.0E-17175224IPR005541KNOX2
PfamPF037891.3E-5282303IPR005539ELK domain
SMARTSM011885.1E-4282303IPR005539ELK domain
PROSITE profilePS512139.969282302IPR005539ELK domain
PROSITE profilePS5007111.677302365IPR001356Homeobox domain
SuperFamilySSF466895.99E-16304369IPR009057Homeodomain-like
SMARTSM003893.5E-11304369IPR001356Homeobox domain
CDDcd000861.75E-11305364No hitNo description
Gene3DG3DSA:1.10.10.602.5E-25309366IPR009057Homeodomain-like
PfamPF059204.6E-18322361IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MAFQDHHHLP REMPIHYAAD PSGAQASLFR SMIPDHRRSP EDKQQQQQQQ PTAWMNNAAV  60
LQHHQWLPTT QGQPSPNSNS PRDKTDHHLR DAGPGGDADN SNGGGGAGGG TNWEREKCKA  120
DILNHPLYEE LLSAHVACLR IATPVDQLPR IDAQLAQSQQ VVAKYSVFGH GQPPLDEKDL  180
DHFMTHYVLL LSSFKEQLQQ HVRVHAMEAV MACWELEQSL QSLTGVAPGE GTGATMSDDD  240
EDQGDSDTNL FDESLDGPDS MGFGPLVPTE SERSLMERVR QELKHELKQG YKDKIVDIRE  300
EILRKRRAGK LPGDTTSVLK AWWQAHSKWP YPTEEDKARL VQETGLQLKQ INNWFINQRK  360
RNWHSNPSSS SSQKSKRKSS EGGKTAANEH YV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12305369872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ0381328e-32JQ038132.1 Prunus persica cultivar Chiripa KNOPE7 (KNOPE7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084049.10.0PREDICTED: homeobox protein knotted-1-like LET12 isoform X1
SwissprotO223001e-169LET12_SOLLC; Homeobox protein knotted-1-like LET12
TrEMBLS8CZT10.0S8CZT1_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_04s0008g06130.t011e-177(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.11e-151KNOTTED1-like homeobox gene 4